Duf5405 family protein
WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. F846_gp29 DUF5405 family protein [] Gene ID: 14181868, updated on 11-Oct-2024. Summary. Other … WebOct 9, 2009 · The structure of Thermotoga maritima protein TM841, a protein from the family formerly called DUF194 (renamed DegV; PF02645), has been solved (Schulze …
Duf5405 family protein
Did you know?
WebThis mouse monoclonal antibody TJ1477 is generated from premade hybridoma library, and specific for Bacillus Phage Shbh1 DUF5405 domain-containing protein. This antibody … WebThis family of IGBTs was designed for optimum performance in the demanding world of motor control operation as well as other high voltage switching applications. These …
WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules) WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. …
WebThe present study suggests that SVB and SVBL play a pivotal role in plant growth and trichome development by affecting a specific subset of known trichome developmental … WebView protein in InterPro IPR035404 DUF5405 Pfam View protein in Pfam PF17399 DUF5405 1 hit MobiDB Search… ProtoNet Search… Sequence Length 100 Mass (Da) 11,356 Last updated 1995-02-01 v1 Checksum 89CBA88D015642CA MFCSRAVVLLNNALKIAVMKNGDLSLIQLGLDKEKREITESVIAIYQSELNLLSDVVNLLVKRAVFHKQISSVDELTKLTTEIASYCADEFKKLNDKRNW …
WebHere we demonstrate that the domain of unknown function 4005 (DUF4005) of the Arabidopsis IQD family protein ABS6/AtIQD16 is a novel MT-binding domain. …
WebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein ... DUF977 family protein plasmid pBD-50-Km_3 : 32860 73 aa hypothetical protein 32865 M: M.Rte9185ORF7915P (100% identity) M.KmiBD50ORF32865P: 32870 76 aa … black note mentholWebMar 10, 2024 · Title: The nuclear pore regulates GAL1 gene transcription by controlling the localization of the SUMO protease Ulp1. A prominent ~50-kDa sumoylated protein accumulates in a Ulp1 coiled-coil domain mutant; that was identified as Scs2, an endoplasmic reticulum (ER) membrane protein that regulates phosphatidylinositol … blacknote pcWebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. orf83 DUF5405 family protein [] Gene ID: 1260634, updated on 18-Nov-2024. Summary. Other designations. DUF5405 family protein ... blacknotepad install locationWebDUF5455 Entrez CDD Structure Protein Help pfam17537: DUF5455 Download alignment Family of unknown function (DUF5455) This is a family of unknown function found in … gardeners plymouth areaWebTry our new Genome page and use the feedback button to let us know what you think black note onlineWebProtein family/group databases. TCDB. 9.A.49.1.3 the prenylated rab acceptor protein 1 (pra1) family; Names & Taxonomy. Protein names. Recommended name. PRA1 family protein 3. Alternative names. ADP-ribosylation factor-like protein 6-interacting protein 5 (ARL-6-interacting protein 5; Aip-5) black note new zealandWebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. … gardeners pharmacy bury